Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 113193..113794 Replicon plasmid pDETEC1
Accession NZ_CP116167
Organism Escherichia coli strain DETEC-P169

Toxin (Protein)


Gene name doc Uniprot ID U9YA20
Locus tag PID12_RS23785 Protein ID WP_001216045.1
Coordinates 113414..113794 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PID12_RS23780 Protein ID WP_001190712.1
Coordinates 113193..113414 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID12_RS23750 (PID12_23745) 108288..108467 + 180 Protein_111 hypothetical protein -
PID12_RS23755 (PID12_23750) 108566..109312 - 747 Protein_112 IS1 family transposase -
PID12_RS23760 (PID12_23755) 109538..111394 + 1857 WP_112014851.1 acyltransferase family protein -
PID12_RS23765 (PID12_23760) 111965..112339 - 375 Protein_114 integrase core domain-containing protein -
PID12_RS23770 (PID12_23765) 112317..112556 - 240 WP_226438661.1 hypothetical protein -
PID12_RS23775 (PID12_23770) 112731..113120 + 390 WP_046660029.1 S24 family peptidase -
PID12_RS23780 (PID12_23775) 113193..113414 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PID12_RS23785 (PID12_23780) 113414..113794 + 381 WP_001216045.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PID12_RS23790 (PID12_23785) 113799..113978 + 180 WP_000113019.1 hypothetical protein -
PID12_RS23795 (PID12_23790) 114006..115049 + 1044 WP_044169711.1 DUF968 domain-containing protein -
PID12_RS23800 (PID12_23795) 115138..115590 + 453 WP_001312282.1 late promoter-activating protein (Gp10) -
PID12_RS23805 (PID12_23800) 115677..116870 + 1194 WP_000219604.1 terminase -
PID12_RS23810 (PID12_23805) 116912..118354 + 1443 WP_223656860.1 terminase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(6)-Id / mph(A) / dfrA14 / blaTEM-1B / sul2 - 1..119948 119948


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(3-120)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13588.29 Da        Isoelectric Point: 5.1514

>T268248 WP_001216045.1 NZ_CP116167:113414-113794 [Escherichia coli]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT268248 WP_001190712.1 NZ_CP116167:113193-113414 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CLP7

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References