Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1335963..1336588 | Replicon | chromosome |
| Accession | NZ_CP116166 | ||
| Organism | Escherichia coli strain DETEC-P169 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PID12_RS06515 | Protein ID | WP_000911330.1 |
| Coordinates | 1336190..1336588 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PID12_RS06510 | Protein ID | WP_000450524.1 |
| Coordinates | 1335963..1336190 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID12_RS06485 (1331766) | 1331766..1332236 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| PID12_RS06490 (1332236) | 1332236..1332808 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PID12_RS06495 (1332954) | 1332954..1333832 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PID12_RS06500 (1333849) | 1333849..1334883 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| PID12_RS06505 (1335096) | 1335096..1335809 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PID12_RS06510 (1335963) | 1335963..1336190 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PID12_RS06515 (1336190) | 1336190..1336588 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PID12_RS06520 (1336735) | 1336735..1337598 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| PID12_RS06525 (1337613) | 1337613..1339628 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PID12_RS06530 (1339702) | 1339702..1340400 | + | 699 | WP_000679823.1 | esterase | - |
| PID12_RS06535 (1340510) | 1340510..1340710 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T268239 WP_000911330.1 NZ_CP116166:1336190-1336588 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|