Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 102581..103206 | Replicon | plasmid pDETEC5 |
Accession | NZ_CP116160 | ||
Organism | Escherichia coli strain DETEC-P351 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1D7QA53 |
Locus tag | PIC26_RS23790 | Protein ID | WP_039023147.1 |
Coordinates | 102581..102979 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A1D7QA08 |
Locus tag | PIC26_RS23795 | Protein ID | WP_039023146.1 |
Coordinates | 102979..103206 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC26_RS23775 (98834) | 98834..99331 | + | 498 | WP_000605862.1 | entry exclusion protein | - |
PIC26_RS23780 (99363) | 99363..100094 | + | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
PIC26_RS23785 (100347) | 100347..102572 | + | 2226 | WP_106493937.1 | type IV conjugative transfer system coupling protein TraD | - |
PIC26_RS23790 (102581) | 102581..102979 | - | 399 | WP_039023147.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC26_RS23795 (102979) | 102979..103206 | - | 228 | WP_039023146.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) | - | 1..116501 | 116501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14885.26 Da Isoelectric Point: 8.2824
>T268227 WP_039023147.1 NZ_CP116160:c102979-102581 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAAIHT
GQIRAELARQGRPVGPFDQMIAGHARCRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA53 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D7QA08 |