Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 44779..45304 Replicon plasmid pDETEC5
Accession NZ_CP116160
Organism Escherichia coli strain DETEC-P351

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PIC26_RS23440 Protein ID WP_001159871.1
Coordinates 44999..45304 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag PIC26_RS23435 Protein ID WP_000813630.1
Coordinates 44779..44997 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC26_RS23410 (39989) 39989..40675 + 687 Protein_45 IS1 family transposase -
PIC26_RS23415 (40929) 40929..41951 - 1023 WP_000361402.1 helicase UvrD -
PIC26_RS23420 (41936) 41936..43501 - 1566 WP_001128474.1 AAA family ATPase -
PIC26_RS23425 (43576) 43576..43992 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
PIC26_RS23430 (43989) 43989..44219 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC26_RS23435 (44779) 44779..44997 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PIC26_RS23440 (44999) 44999..45304 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PIC26_RS23445 (45305) 45305..46111 + 807 WP_000016970.1 site-specific integrase -
PIC26_RS23450 (46833) 46833..47588 + 756 WP_000852146.1 replication initiation protein RepE -
PIC26_RS23455 (48176) 48176..49342 + 1167 WP_000772446.1 plasmid-partitioning protein SopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) - 1..116501 116501


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T268223 WP_001159871.1 NZ_CP116160:44999-45304 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT268223 WP_000813630.1 NZ_CP116160:44779-44997 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References