Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 44779..45304 | Replicon | plasmid pDETEC5 |
Accession | NZ_CP116160 | ||
Organism | Escherichia coli strain DETEC-P351 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | PIC26_RS23440 | Protein ID | WP_001159871.1 |
Coordinates | 44999..45304 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H9TJP1 |
Locus tag | PIC26_RS23435 | Protein ID | WP_000813630.1 |
Coordinates | 44779..44997 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC26_RS23410 (39989) | 39989..40675 | + | 687 | Protein_45 | IS1 family transposase | - |
PIC26_RS23415 (40929) | 40929..41951 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
PIC26_RS23420 (41936) | 41936..43501 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
PIC26_RS23425 (43576) | 43576..43992 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
PIC26_RS23430 (43989) | 43989..44219 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC26_RS23435 (44779) | 44779..44997 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PIC26_RS23440 (44999) | 44999..45304 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PIC26_RS23445 (45305) | 45305..46111 | + | 807 | WP_000016970.1 | site-specific integrase | - |
PIC26_RS23450 (46833) | 46833..47588 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PIC26_RS23455 (48176) | 48176..49342 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) | - | 1..116501 | 116501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T268223 WP_001159871.1 NZ_CP116160:44999-45304 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CEF5 |