Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 43576..44219 | Replicon | plasmid pDETEC5 |
| Accession | NZ_CP116160 | ||
| Organism | Escherichia coli strain DETEC-P351 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | PIC26_RS23425 | Protein ID | WP_001034044.1 |
| Coordinates | 43576..43992 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | PIC26_RS23430 | Protein ID | WP_001261286.1 |
| Coordinates | 43989..44219 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC26_RS23400 (38829) | 38829..38942 | - | 114 | Protein_43 | IS6 family transposase | - |
| PIC26_RS23405 (39142) | 39142..39839 | + | 698 | WP_223350503.1 | IS1 family transposase | - |
| PIC26_RS23410 (39989) | 39989..40675 | + | 687 | Protein_45 | IS1 family transposase | - |
| PIC26_RS23415 (40929) | 40929..41951 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| PIC26_RS23420 (41936) | 41936..43501 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| PIC26_RS23425 (43576) | 43576..43992 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC26_RS23430 (43989) | 43989..44219 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIC26_RS23435 (44779) | 44779..44997 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| PIC26_RS23440 (44999) | 44999..45304 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| PIC26_RS23445 (45305) | 45305..46111 | + | 807 | WP_000016970.1 | site-specific integrase | - |
| PIC26_RS23450 (46833) | 46833..47588 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) | - | 1..116501 | 116501 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T268222 WP_001034044.1 NZ_CP116160:c43992-43576 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |