Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 43576..44219 Replicon plasmid pDETEC5
Accession NZ_CP116160
Organism Escherichia coli strain DETEC-P351

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag PIC26_RS23425 Protein ID WP_001034044.1
Coordinates 43576..43992 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag PIC26_RS23430 Protein ID WP_001261286.1
Coordinates 43989..44219 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC26_RS23400 (38829) 38829..38942 - 114 Protein_43 IS6 family transposase -
PIC26_RS23405 (39142) 39142..39839 + 698 WP_223350503.1 IS1 family transposase -
PIC26_RS23410 (39989) 39989..40675 + 687 Protein_45 IS1 family transposase -
PIC26_RS23415 (40929) 40929..41951 - 1023 WP_000361402.1 helicase UvrD -
PIC26_RS23420 (41936) 41936..43501 - 1566 WP_001128474.1 AAA family ATPase -
PIC26_RS23425 (43576) 43576..43992 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC26_RS23430 (43989) 43989..44219 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC26_RS23435 (44779) 44779..44997 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
PIC26_RS23440 (44999) 44999..45304 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
PIC26_RS23445 (45305) 45305..46111 + 807 WP_000016970.1 site-specific integrase -
PIC26_RS23450 (46833) 46833..47588 + 756 WP_000852146.1 replication initiation protein RepE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A) - 1..116501 116501


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T268222 WP_001034044.1 NZ_CP116160:c43992-43576 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT268222 WP_001261286.1 NZ_CP116160:c44219-43989 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References