Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3496692..3497310 | Replicon | chromosome |
Accession | NZ_CP116159 | ||
Organism | Escherichia coli strain DETEC-P351 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC26_RS16915 | Protein ID | WP_001291435.1 |
Coordinates | 3497092..3497310 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | PIC26_RS16910 | Protein ID | WP_271286571.1 |
Coordinates | 3496692..3497066 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC26_RS16900 (3491781) | 3491781..3492974 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIC26_RS16905 (3492997) | 3492997..3496146 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIC26_RS16910 (3496692) | 3496692..3497066 | + | 375 | WP_271286571.1 | Hha toxicity modulator TomB | Antitoxin |
PIC26_RS16915 (3497092) | 3497092..3497310 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC26_RS16920 (3497482) | 3497482..3498033 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PIC26_RS16925 (3498149) | 3498149..3498619 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PIC26_RS16930 (3498783) | 3498783..3500333 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC26_RS16935 (3500375) | 3500375..3500728 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIC26_RS16945 (3501107) | 3501107..3501418 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PIC26_RS16950 (3501449) | 3501449..3502021 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268216 WP_001291435.1 NZ_CP116159:3497092-3497310 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14543.36 Da Isoelectric Point: 4.7395
>AT268216 WP_271286571.1 NZ_CP116159:3496692-3497066 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSGINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSGINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|