Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1875736..1876571 | Replicon | chromosome |
| Accession | NZ_CP116159 | ||
| Organism | Escherichia coli strain DETEC-P351 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1X9TM58 |
| Locus tag | PIC26_RS08990 | Protein ID | WP_000854761.1 |
| Coordinates | 1875736..1876113 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | PIC26_RS08995 | Protein ID | WP_001295723.1 |
| Coordinates | 1876203..1876571 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC26_RS08950 (1871125) | 1871125..1871391 | - | 267 | WP_087757644.1 | EutP/PduV family microcompartment system protein | - |
| PIC26_RS08955 (1871761) | 1871761..1872150 | - | 390 | WP_001445118.1 | IS110 family transposase | - |
| PIC26_RS08960 (1872339) | 1872339..1872563 | - | 225 | Protein_1753 | transposase | - |
| PIC26_RS08965 (1872644) | 1872644..1873048 | + | 405 | WP_000839179.1 | transposase | - |
| PIC26_RS08970 (1873045) | 1873045..1873392 | + | 348 | WP_000612626.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PIC26_RS08975 (1873441) | 1873441..1874980 | + | 1540 | Protein_1756 | IS66-like element ISEc22 family transposase | - |
| PIC26_RS08980 (1875411) | 1875411..1875491 | - | 81 | Protein_1757 | hypothetical protein | - |
| PIC26_RS08985 (1875591) | 1875591..1875739 | - | 149 | Protein_1758 | DUF5983 family protein | - |
| PIC26_RS08990 (1875736) | 1875736..1876113 | - | 378 | WP_000854761.1 | TA system toxin CbtA family protein | Toxin |
| PIC26_RS08995 (1876203) | 1876203..1876571 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIC26_RS09000 (1876734) | 1876734..1876955 | - | 222 | WP_000692341.1 | DUF987 domain-containing protein | - |
| PIC26_RS09005 (1877018) | 1877018..1877494 | - | 477 | WP_001186774.1 | RadC family protein | - |
| PIC26_RS09010 (1877510) | 1877510..1877983 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| PIC26_RS09015 (1878325) | 1878325..1879143 | - | 819 | WP_001234729.1 | DUF932 domain-containing protein | - |
| PIC26_RS09020 (1879261) | 1879261..1879456 | - | 196 | Protein_1765 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14205.25 Da Isoelectric Point: 7.3249
>T268209 WP_000854761.1 NZ_CP116159:c1876113-1875736 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT268209 WP_001295723.1 NZ_CP116159:c1876571-1876203 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1X9TM58 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |