Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 795994..796826 Replicon chromosome
Accession NZ_CP116159
Organism Escherichia coli strain DETEC-P351

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZVJ9
Locus tag PIC26_RS03880 Protein ID WP_000854765.1
Coordinates 795994..796368 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1NM52
Locus tag PIC26_RS03885 Protein ID WP_001295723.1
Coordinates 796458..796826 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC26_RS03845 (791072) 791072..791671 + 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -
PIC26_RS03850 (791674) 791674..792651 + 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
PIC26_RS03855 (792648) 792648..793826 + 1179 WP_000094991.1 type II secretion system protein GspL -
PIC26_RS03860 (793828) 793828..794364 + 537 WP_000942785.1 GspM family type II secretion system protein YghD -
PIC26_RS03865 (794645) 794645..795487 - 843 WP_022645115.1 DUF4942 domain-containing protein -
PIC26_RS03870 (795572) 795572..795766 - 195 WP_024181941.1 DUF957 domain-containing protein -
PIC26_RS03875 (795791) 795791..795994 - 204 WP_001398797.1 DUF5983 family protein -
PIC26_RS03880 (795994) 795994..796368 - 375 WP_000854765.1 TA system toxin CbtA family protein Toxin
PIC26_RS03885 (796458) 796458..796826 - 369 WP_001295723.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIC26_RS03890 (796989) 796989..797210 - 222 WP_000692341.1 DUF987 domain-containing protein -
PIC26_RS03895 (797273) 797273..797749 - 477 WP_001186774.1 RadC family protein -
PIC26_RS03900 (797765) 797765..798244 - 480 WP_057109541.1 antirestriction protein -
PIC26_RS03905 (798510) 798510..799328 - 819 WP_001175165.1 DUF932 domain-containing protein -
PIC26_RS03910 (799418) 799418..799651 - 234 WP_001278293.1 DUF905 family protein -
PIC26_RS03915 (799657) 799657..800334 - 678 WP_001097302.1 hypothetical protein -
PIC26_RS03920 (800482) 800482..801162 - 681 WP_001282921.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13970.98 Da        Isoelectric Point: 7.2909

>T268205 WP_000854765.1 NZ_CP116159:c796368-795994 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13592.40 Da        Isoelectric Point: 6.6255

>AT268205 WP_001295723.1 NZ_CP116159:c796826-796458 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZVJ9

Antitoxin

Source ID Structure
AlphaFold DB S1NM52

References