Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 795994..796826 | Replicon | chromosome |
| Accession | NZ_CP116159 | ||
| Organism | Escherichia coli strain DETEC-P351 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | PIC26_RS03880 | Protein ID | WP_000854765.1 |
| Coordinates | 795994..796368 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | PIC26_RS03885 | Protein ID | WP_001295723.1 |
| Coordinates | 796458..796826 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC26_RS03845 (791072) | 791072..791671 | + | 600 | WP_001255034.1 | type II secretion system minor pseudopilin GspJ | - |
| PIC26_RS03850 (791674) | 791674..792651 | + | 978 | WP_000633209.1 | type II secretion system minor pseudopilin GspK | - |
| PIC26_RS03855 (792648) | 792648..793826 | + | 1179 | WP_000094991.1 | type II secretion system protein GspL | - |
| PIC26_RS03860 (793828) | 793828..794364 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| PIC26_RS03865 (794645) | 794645..795487 | - | 843 | WP_022645115.1 | DUF4942 domain-containing protein | - |
| PIC26_RS03870 (795572) | 795572..795766 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| PIC26_RS03875 (795791) | 795791..795994 | - | 204 | WP_001398797.1 | DUF5983 family protein | - |
| PIC26_RS03880 (795994) | 795994..796368 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| PIC26_RS03885 (796458) | 796458..796826 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIC26_RS03890 (796989) | 796989..797210 | - | 222 | WP_000692341.1 | DUF987 domain-containing protein | - |
| PIC26_RS03895 (797273) | 797273..797749 | - | 477 | WP_001186774.1 | RadC family protein | - |
| PIC26_RS03900 (797765) | 797765..798244 | - | 480 | WP_057109541.1 | antirestriction protein | - |
| PIC26_RS03905 (798510) | 798510..799328 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| PIC26_RS03910 (799418) | 799418..799651 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| PIC26_RS03915 (799657) | 799657..800334 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| PIC26_RS03920 (800482) | 800482..801162 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T268205 WP_000854765.1 NZ_CP116159:c796368-795994 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT268205 WP_001295723.1 NZ_CP116159:c796826-796458 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|