Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 108025..108668 | Replicon | plasmid pDETEC38 |
| Accession | NZ_CP116154 | ||
| Organism | Escherichia coli strain DETEC-P61 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | PIC71_RS24215 | Protein ID | WP_001034044.1 |
| Coordinates | 108252..108668 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | PIC71_RS24210 | Protein ID | WP_001261286.1 |
| Coordinates | 108025..108255 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC71_RS24195 (103162) | 103162..103392 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIC71_RS24200 (103389) | 103389..103805 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| PIC71_RS24205 (103850) | 103850..107644 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| PIC71_RS24210 (108025) | 108025..108255 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIC71_RS24215 (108252) | 108252..108668 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC71_RS24220 (108743) | 108743..110308 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| PIC71_RS24225 (110293) | 110293..111315 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..128466 | 128466 | |
| - | flank | IS/Tn | - | - | 111569..111946 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T268201 WP_001034044.1 NZ_CP116154:108252-108668 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |