Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 103162..103805 Replicon plasmid pDETEC38
Accession NZ_CP116154
Organism Escherichia coli strain DETEC-P61

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PIC71_RS24200 Protein ID WP_001034046.1
Coordinates 103389..103805 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PIC71_RS24195 Protein ID WP_001261278.1
Coordinates 103162..103392 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC71_RS24165 (98672) 98672..98977 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PIC71_RS24170 (98979) 98979..99197 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PIC71_RS24175 (99765) 99765..100277 + 513 WP_000151784.1 hypothetical protein -
PIC71_RS24180 (100311) 100311..101444 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
PIC71_RS24185 (101611) 101611..102384 - 774 WP_000905949.1 hypothetical protein -
PIC71_RS24190 (102397) 102397..102897 - 501 WP_000528931.1 HEPN family nuclease -
PIC71_RS24195 (103162) 103162..103392 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC71_RS24200 (103389) 103389..103805 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC71_RS24205 (103850) 103850..107644 - 3795 WP_001144732.1 hypothetical protein -
PIC71_RS24210 (108025) 108025..108255 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC71_RS24215 (108252) 108252..108668 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD iutA / iucD / iucC / iucB / iucA 1..128466 128466


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T268200 WP_001034046.1 NZ_CP116154:103389-103805 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT268200 WP_001261278.1 NZ_CP116154:103162-103392 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References