Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 103162..103805 | Replicon | plasmid pDETEC38 |
| Accession | NZ_CP116154 | ||
| Organism | Escherichia coli strain DETEC-P61 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | PIC71_RS24200 | Protein ID | WP_001034046.1 |
| Coordinates | 103389..103805 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | PIC71_RS24195 | Protein ID | WP_001261278.1 |
| Coordinates | 103162..103392 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC71_RS24165 (98672) | 98672..98977 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
| PIC71_RS24170 (98979) | 98979..99197 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| PIC71_RS24175 (99765) | 99765..100277 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| PIC71_RS24180 (100311) | 100311..101444 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
| PIC71_RS24185 (101611) | 101611..102384 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| PIC71_RS24190 (102397) | 102397..102897 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
| PIC71_RS24195 (103162) | 103162..103392 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIC71_RS24200 (103389) | 103389..103805 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC71_RS24205 (103850) | 103850..107644 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| PIC71_RS24210 (108025) | 108025..108255 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIC71_RS24215 (108252) | 108252..108668 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..128466 | 128466 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T268200 WP_001034046.1 NZ_CP116154:103389-103805 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |