Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 98672..99197 | Replicon | plasmid pDETEC38 |
Accession | NZ_CP116154 | ||
Organism | Escherichia coli strain DETEC-P61 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | PIC71_RS24165 | Protein ID | WP_001159868.1 |
Coordinates | 98672..98977 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PIC71_RS24170 | Protein ID | WP_000813634.1 |
Coordinates | 98979..99197 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC71_RS24150 (94582) | 94582..95748 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
PIC71_RS24155 (96336) | 96336..97091 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PIC71_RS24160 (97865) | 97865..98671 | - | 807 | WP_000016982.1 | site-specific integrase | - |
PIC71_RS24165 (98672) | 98672..98977 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PIC71_RS24170 (98979) | 98979..99197 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PIC71_RS24175 (99765) | 99765..100277 | + | 513 | WP_000151784.1 | hypothetical protein | - |
PIC71_RS24180 (100311) | 100311..101444 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
PIC71_RS24185 (101611) | 101611..102384 | - | 774 | WP_000905949.1 | hypothetical protein | - |
PIC71_RS24190 (102397) | 102397..102897 | - | 501 | WP_000528931.1 | HEPN family nuclease | - |
PIC71_RS24195 (103162) | 103162..103392 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC71_RS24200 (103389) | 103389..103805 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..128466 | 128466 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T268199 WP_001159868.1 NZ_CP116154:c98977-98672 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|