Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 8463..9022 Replicon plasmid pDETEC38
Accession NZ_CP116154
Organism Escherichia coli strain DETEC-P61

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag PIC71_RS23605 Protein ID WP_000421272.1
Coordinates 8463..8738 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag PIC71_RS23610 Protein ID WP_001387467.1
Coordinates 8738..9022 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC71_RS23570 (4037) 4037..4219 - 183 WP_042344623.1 hypothetical protein -
PIC71_RS23575 (4286) 4286..4575 - 290 Protein_6 type II toxin-antitoxin system RelE/ParE family toxin -
PIC71_RS23580 (4562) 4562..4830 - 269 Protein_7 type II toxin-antitoxin system ParD family antitoxin -
PIC71_RS23585 (4991) 4991..6219 + 1229 WP_113708090.1 IS3-like element IS2 family transposase -
PIC71_RS23590 (6698) 6698..7612 + 915 WP_223429136.1 hypothetical protein -
PIC71_RS23595 (7901) 7901..8029 + 129 Protein_10 IS481 family transposase -
PIC71_RS23600 (8154) 8154..8357 - 204 Protein_11 hypothetical protein -
PIC71_RS23605 (8463) 8463..8738 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PIC71_RS23610 (8738) 8738..9022 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
PIC71_RS23615 (9627) 9627..10379 + 753 WP_000562172.1 IclR family transcriptional regulator -
PIC71_RS23620 (10425) 10425..10694 - 270 Protein_15 2-keto-3-deoxygluconate permease -
PIC71_RS23625 (10755) 10755..11459 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
PIC71_RS23630 (11512) 11512..11748 - 237 Protein_17 DUF3330 domain-containing protein -
PIC71_RS23635 (11951) 11951..12964 - 1014 WP_000845048.1 class 1 integron integrase IntI1 -
PIC71_RS23640 (13113) 13113..13951 + 839 Protein_19 AadA family aminoglycoside 3''-O-nucleotidyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD iutA / iucD / iucC / iucB / iucA 1..128466 128466
- inside IScluster/Tn ant(3'')-Ia / mph(A) / blaNDM-5 - 812..36711 35899


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T268195 WP_000421272.1 NZ_CP116154:c8738-8463 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT268195 WP_001387467.1 NZ_CP116154:c9022-8738 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References