Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 25157..25758 Replicon plasmid pDETEC37
Accession NZ_CP116153
Organism Escherichia coli strain DETEC-P61

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PIC71_RS22970 Protein ID WP_001216034.1
Coordinates 25378..25758 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PIC71_RS22965 Protein ID WP_001190712.1
Coordinates 25157..25378 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC71_RS22955 (PIC71_22955) 22183..23421 - 1239 WP_038997080.1 restriction endonuclease subunit S -
PIC71_RS22960 (PIC71_22960) 23418..24974 - 1557 WP_038997084.1 type I restriction-modification system subunit M -
PIC71_RS22965 (PIC71_22965) 25157..25378 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PIC71_RS22970 (PIC71_22970) 25378..25758 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PIC71_RS22975 (PIC71_22975) 25763..25942 + 180 WP_038997082.1 hypothetical protein -
PIC71_RS22980 (PIC71_22980) 25970..26434 + 465 Protein_28 hypothetical protein -
PIC71_RS22990 (PIC71_22990) 27201..27563 + 363 Protein_30 phage antirepressor KilAC domain-containing protein -
PIC71_RS22995 (PIC71_22995) 27596..28447 - 852 WP_000611664.1 phage repressor protein C1 -
PIC71_RS23000 (PIC71_23000) 28558..28767 - 210 WP_000874156.1 hypothetical protein -
PIC71_RS23005 (PIC71_23005) 28938..29635 + 698 WP_094096600.1 IS1-like element IS1A family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mph(A) / sul1 / qacE / qnrB6 / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / oqxB / oqxA / aph(3'')-Ib / aph(6)-Id - 1..142064 142064
- flank IS/Tn - - 26448..26951 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T268193 WP_001216034.1 NZ_CP116153:25378-25758 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT268193 WP_001190712.1 NZ_CP116153:25157-25378 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References