Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2396649..2397287 | Replicon | chromosome |
Accession | NZ_CP116152 | ||
Organism | Escherichia coli strain DETEC-P61 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PIC71_RS11830 | Protein ID | WP_000813794.1 |
Coordinates | 2397111..2397287 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PIC71_RS11825 | Protein ID | WP_001270286.1 |
Coordinates | 2396649..2397065 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC71_RS11805 (2391801) | 2391801..2392742 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
PIC71_RS11810 (2392743) | 2392743..2393756 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
PIC71_RS11815 (2393774) | 2393774..2394919 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
PIC71_RS11820 (2395164) | 2395164..2396570 | - | 1407 | WP_000760585.1 | PLP-dependent aminotransferase family protein | - |
PIC71_RS11825 (2396649) | 2396649..2397065 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PIC71_RS11830 (2397111) | 2397111..2397287 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PIC71_RS11835 (2397509) | 2397509..2397739 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PIC71_RS11840 (2397831) | 2397831..2399792 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PIC71_RS11845 (2399865) | 2399865..2400401 | - | 537 | WP_063120676.1 | DNA-binding transcriptional regulator SutR | - |
PIC71_RS11850 (2400493) | 2400493..2401668 | + | 1176 | WP_001236251.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2401708..2402973 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T268188 WP_000813794.1 NZ_CP116152:c2397287-2397111 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT268188 WP_001270286.1 NZ_CP116152:c2397065-2396649 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|