Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 4971..5518 Replicon plasmid pDETEC57
Accession NZ_CP116148
Organism Escherichia coli strain DETEC-P622

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag PIB88_RS25905 Protein ID WP_244449344.1
Coordinates 5240..5518 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E2GHF7
Locus tag PIB88_RS25900 Protein ID WP_012881119.1
Coordinates 4971..5240 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB88_RS25870 (PIB88_25870) 137..562 + 426 WP_000422741.1 transposase -
PIB88_RS25875 (PIB88_25875) 559..909 + 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
PIB88_RS25880 (PIB88_25880) 940..2553 + 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
PIB88_RS25885 (PIB88_25885) 2641..2895 + 255 WP_000083830.1 replication regulatory protein RepA -
PIB88_RS25890 (PIB88_25890) 3133..3207 + 75 WP_001365705.1 RepA leader peptide Tap -
PIB88_RS25895 (PIB88_25895) 3200..4057 + 858 WP_000130646.1 incFII family plasmid replication initiator RepA -
PIB88_RS25900 (PIB88_25900) 4971..5240 + 270 WP_012881119.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PIB88_RS25905 (PIB88_25905) 5240..5518 + 279 WP_244449344.1 type II toxin-antitoxin system toxin YacB Toxin
PIB88_RS25910 (PIB88_25910) 5564..6412 + 849 WP_012881117.1 3'-5' exonuclease -
PIB88_RS25915 (PIB88_25915) 6529..7011 + 483 WP_001311056.1 hypothetical protein -
PIB88_RS25920 (PIB88_25920) 7046..8068 - 1023 Protein_10 maltoporin LamB -
PIB88_RS25925 (PIB88_25925) 8117..8524 - 408 Protein_11 IS5-like element IS903B family transposase -
PIB88_RS25930 (PIB88_25930) 8604..9479 - 876 WP_001617865.1 extended-spectrum class A beta-lactamase CTX-M-14 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-14 - 1..13744 13744
- flank IS/Tn blaCTX-M-14 - 8604..11169 2565


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10744.34 Da        Isoelectric Point: 8.4615

>T268178 WP_244449344.1 NZ_CP116148:5240-5518 [Escherichia coli]
MEIFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10206.54 Da        Isoelectric Point: 8.8735

>AT268178 WP_012881119.1 NZ_CP116148:4971-5240 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLERGDVLPHDMVESSATAWRD
EISRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4Y1YSD8

References