Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 99040..99641 Replicon plasmid pDETEC55
Accession NZ_CP116146
Organism Escherichia coli strain DETEC-P622

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag PIB88_RS25305 Protein ID WP_001216034.1
Coordinates 99261..99641 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PIB88_RS25300 Protein ID WP_001190712.1
Coordinates 99040..99261 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB88_RS25290 (96021) 96021..97304 - 1284 WP_001617890.1 restriction endonuclease subunit S -
PIB88_RS25295 (97301) 97301..98857 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
PIB88_RS25300 (99040) 99040..99261 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PIB88_RS25305 (99261) 99261..99641 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PIB88_RS25310 (99646) 99646..99825 + 180 WP_001513661.1 hypothetical protein -
PIB88_RS25315 (99853) 99853..100131 + 279 Protein_125 pdcB -
PIB88_RS25320 (100136) 100136..100549 + 414 Protein_126 integrase core domain-containing protein -
PIB88_RS25325 (100499) 100499..100834 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
PIB88_RS25330 (101044) 101044..102024 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
PIB88_RS25335 (102268) 102268..103671 + 1404 WP_001373486.1 S-methylmethionine permease -
PIB88_RS25340 (103658) 103658..104590 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul1 / aadA5 / mph(A) / blaTEM-1B / aac(3)-IId senB 1..107932 107932


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T268174 WP_001216034.1 NZ_CP116146:99261-99641 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT268174 WP_001190712.1 NZ_CP116146:99040-99261 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References