Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 88571..89096 | Replicon | plasmid pDETEC55 |
| Accession | NZ_CP116146 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | PIB88_RS25260 | Protein ID | WP_001159868.1 |
| Coordinates | 88571..88876 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PIB88_RS25265 | Protein ID | WP_000813634.1 |
| Coordinates | 88878..89096 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS25245 (84503) | 84503..85669 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| PIB88_RS25250 (86257) | 86257..87012 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| PIB88_RS25255 (87764) | 87764..88570 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| PIB88_RS25260 (88571) | 88571..88876 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PIB88_RS25265 (88878) | 88878..89096 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PIB88_RS25270 (89804) | 89804..90799 | + | 996 | WP_000246636.1 | hypothetical protein | - |
| PIB88_RS25275 (90842) | 90842..91735 | + | 894 | WP_001553853.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sul1 / aadA5 / mph(A) / blaTEM-1B / aac(3)-IId | senB | 1..107932 | 107932 | |
| - | flank | IS/Tn | - | - | 91872..92375 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T268173 WP_001159868.1 NZ_CP116146:c88876-88571 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|