Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4026303..4026921 | Replicon | chromosome |
| Accession | NZ_CP116145 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIB88_RS19405 | Protein ID | WP_001291435.1 |
| Coordinates | 4026303..4026521 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIB88_RS19410 | Protein ID | WP_000344800.1 |
| Coordinates | 4026547..4026921 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS19370 (4021590) | 4021590..4022162 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| PIB88_RS19375 (4022193) | 4022193..4022504 | - | 312 | WP_000409908.1 | MGMT family protein | - |
| PIB88_RS19385 (4022883) | 4022883..4023236 | + | 354 | WP_000878135.1 | DUF1428 family protein | - |
| PIB88_RS19390 (4023278) | 4023278..4024828 | - | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIB88_RS19395 (4024992) | 4024992..4025462 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| PIB88_RS19400 (4025578) | 4025578..4026129 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| PIB88_RS19405 (4026303) | 4026303..4026521 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIB88_RS19410 (4026547) | 4026547..4026921 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIB88_RS19415 (4027467) | 4027467..4030616 | - | 3150 | WP_271287807.1 | efflux RND transporter permease AcrB | - |
| PIB88_RS19420 (4030639) | 4030639..4031832 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268164 WP_001291435.1 NZ_CP116145:c4026521-4026303 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268164 WP_000344800.1 NZ_CP116145:c4026921-4026547 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |