Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3574712..3575232 Replicon chromosome
Accession NZ_CP116145
Organism Escherichia coli strain DETEC-P622

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag PIB88_RS17250 Protein ID WP_001160964.1
Coordinates 3574948..3575232 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag PIB88_RS17245 Protein ID WP_000125566.1
Coordinates 3574712..3574945 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB88_RS17220 (3569785) 3569785..3570072 + 288 WP_000203744.1 ferredoxin-like protein FixX -
PIB88_RS17225 (3570131) 3570131..3571462 + 1332 WP_001183209.1 MFS transporter -
PIB88_RS17230 (3571570) 3571570..3572100 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PIB88_RS17235 (3572093) 3572093..3573955 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
PIB88_RS17240 (3574147) 3574147..3574626 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
PIB88_RS17245 (3574712) 3574712..3574945 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PIB88_RS17250 (3574948) 3574948..3575232 + 285 WP_001160964.1 CcdB family protein Toxin
PIB88_RS17255 (3575259) 3575259..3576107 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PIB88_RS17260 (3576114) 3576114..3576491 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PIB88_RS17265 (3576494) 3576494..3577315 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PIB88_RS17270 (3577312) 3577312..3578301 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PIB88_RS17275 (3578301) 3578301..3579587 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T268162 WP_001160964.1 NZ_CP116145:3574948-3575232 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT268162 WP_000125566.1 NZ_CP116145:3574712-3574945 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References