Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3381575..3382410 | Replicon | chromosome |
| Accession | NZ_CP116145 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | PIB88_RS16310 | Protein ID | WP_000854759.1 |
| Coordinates | 3382033..3382410 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | PIB88_RS16305 | Protein ID | WP_001295723.1 |
| Coordinates | 3381575..3381943 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS16275 (3376697) | 3376697..3378238 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| PIB88_RS16280 (3378253) | 3378253..3378999 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PIB88_RS16285 (3379084) | 3379084..3379821 | + | 738 | Protein_3177 | DUF932 domain-containing protein | - |
| PIB88_RS16290 (3380163) | 3380163..3380636 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| PIB88_RS16295 (3380652) | 3380652..3381128 | + | 477 | WP_001186775.1 | RadC family protein | - |
| PIB88_RS16300 (3381191) | 3381191..3381412 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| PIB88_RS16305 (3381575) | 3381575..3381943 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB88_RS16310 (3382033) | 3382033..3382410 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| PIB88_RS16315 (3382407) | 3382407..3382895 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| PIB88_RS16320 (3382912) | 3382912..3383088 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| PIB88_RS16325 (3383194) | 3383194..3383343 | + | 150 | Protein_3185 | hypothetical protein | - |
| PIB88_RS16330 (3383710) | 3383710..3383886 | + | 177 | Protein_3186 | helix-turn-helix domain-containing protein | - |
| PIB88_RS16335 (3384677) | 3384677..3386299 | + | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T268160 WP_000854759.1 NZ_CP116145:3382033-3382410 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT268160 WP_001295723.1 NZ_CP116145:3381575-3381943 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |