Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1823711..1824545 Replicon chromosome
Accession NZ_CP116145
Organism Escherichia coli strain DETEC-P622

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag PIB88_RS08815 Protein ID WP_000854690.1
Coordinates 1824168..1824545 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag PIB88_RS08810 Protein ID WP_001305076.1
Coordinates 1823711..1824079 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB88_RS08770 (1818793) 1818793..1819920 + 1128 Protein_1719 hypothetical protein -
PIB88_RS08775 (1819996) 1819996..1820451 + 456 WP_000581502.1 IrmA family protein -
PIB88_RS08780 (1820530) 1820530..1820763 + 234 WP_000902034.1 DUF905 family protein -
PIB88_RS08785 (1820864) 1820864..1821682 + 819 WP_001234620.1 DUF932 domain-containing protein -
PIB88_RS08790 (1821737) 1821737..1822222 + 486 WP_000849565.1 antirestriction protein -
PIB88_RS08795 (1822238) 1822238..1822714 + 477 WP_001186726.1 RadC family protein -
PIB88_RS08800 (1822777) 1822777..1822998 + 222 WP_000692329.1 DUF987 domain-containing protein -
PIB88_RS08805 (1823017) 1823017..1823661 + 645 WP_000094916.1 hypothetical protein -
PIB88_RS08810 (1823711) 1823711..1824079 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIB88_RS08815 (1824168) 1824168..1824545 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
PIB88_RS08820 (1824542) 1824542..1825030 + 489 WP_000761699.1 DUF5983 family protein -
PIB88_RS08825 (1825047) 1825047..1825244 + 198 WP_000839293.1 DUF957 domain-containing protein -
PIB88_RS08830 (1825329) 1825329..1826174 + 846 WP_001529401.1 DUF4942 domain-containing protein -
PIB88_RS08835 (1826243) 1826243..1826638 + 396 WP_000208384.1 DUF6088 family protein -
PIB88_RS08840 (1826631) 1826631..1827564 + 934 Protein_1733 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
PIB88_RS08845 (1827981) 1827981..1828151 + 171 Protein_1734 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 1779433..1845754 66321
- flank IS/Tn - - 1827996..1828151 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T268153 WP_000854690.1 NZ_CP116145:1824168-1824545 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT268153 WP_001305076.1 NZ_CP116145:1823711-1824079 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References