Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1678798..1679452 | Replicon | chromosome |
| Accession | NZ_CP116145 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | PIB88_RS08030 | Protein ID | WP_000244765.1 |
| Coordinates | 1678798..1679205 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | F4T2L5 |
| Locus tag | PIB88_RS08035 | Protein ID | WP_000354050.1 |
| Coordinates | 1679186..1679452 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS08010 (1674755) | 1674755..1676488 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PIB88_RS08015 (1676494) | 1676494..1677204 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIB88_RS08020 (1677229) | 1677229..1678125 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIB88_RS08025 (1678237) | 1678237..1678758 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIB88_RS08030 (1678798) | 1678798..1679205 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
| PIB88_RS08035 (1679186) | 1679186..1679452 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
| PIB88_RS08040 (1679695) | 1679695..1680675 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
| PIB88_RS08045 (1680752) | 1680752..1681411 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
| PIB88_RS08050 (1681575) | 1681575..1681886 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIB88_RS08055 (1681931) | 1681931..1683364 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T268152 WP_000244765.1 NZ_CP116145:c1679205-1678798 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061L3F4 |