Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 135615..136140 | Replicon | plasmid pDETEC25 |
Accession | NZ_CP116137 | ||
Organism | Escherichia coli strain DETEC-P649 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | PIB66_RS24630 | Protein ID | WP_001159868.1 |
Coordinates | 135615..135920 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PIB66_RS24635 | Protein ID | WP_000813634.1 |
Coordinates | 135922..136140 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB66_RS24615 (131525) | 131525..132691 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
PIB66_RS24620 (133279) | 133279..134034 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PIB66_RS24625 (134808) | 134808..135614 | - | 807 | WP_000016982.1 | site-specific integrase | - |
PIB66_RS24630 (135615) | 135615..135920 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PIB66_RS24635 (135922) | 135922..136140 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PIB66_RS24640 (136848) | 136848..137843 | + | 996 | WP_000246635.1 | hypothetical protein | - |
PIB66_RS24645 (137847) | 137847..138779 | + | 933 | WP_000991831.1 | S-4TM family putative pore-forming effector | - |
PIB66_RS24650 (139077) | 139077..140165 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
PIB66_RS24655 (140158) | 140158..141036 | + | 879 | WP_225522546.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(B) / dfrA1 / blaCTX-M-14 / qacE / cmlA1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1B | - | 1..151807 | 151807 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T268145 WP_001159868.1 NZ_CP116137:c135920-135615 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|