Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 5251..5810 Replicon plasmid pDETEC25
Accession NZ_CP116137
Organism Escherichia coli strain DETEC-P649

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag PIB66_RS23830 Protein ID WP_000421272.1
Coordinates 5251..5526 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag PIB66_RS23835 Protein ID WP_001387467.1
Coordinates 5526..5810 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB66_RS23800 (1301) 1301..2041 - 741 WP_016238487.1 tyrosine-type recombinase/integrase -
PIB66_RS23805 (2411) 2411..2700 - 290 Protein_2 type II toxin-antitoxin system RelE/ParE family toxin -
PIB66_RS23810 (2687) 2687..2955 - 269 Protein_3 type II toxin-antitoxin system ParD family antitoxin -
PIB66_RS23815 (3487) 3487..4656 + 1170 WP_001072355.1 hypothetical protein -
PIB66_RS23820 (4689) 4689..4817 + 129 Protein_5 IS481 family transposase -
PIB66_RS23825 (4942) 4942..5145 - 204 Protein_6 hypothetical protein -
PIB66_RS23830 (5251) 5251..5526 - 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PIB66_RS23835 (5526) 5526..5810 - 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
PIB66_RS23840 (6415) 6415..7167 + 753 WP_000562172.1 IclR family transcriptional regulator -
PIB66_RS23845 (7213) 7213..8178 - 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
PIB66_RS23850 (8211) 8211..8591 - 381 WP_000710783.1 Rid family detoxifying hydrolase -
PIB66_RS23855 (8616) 8616..9506 - 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
PIB66_RS23860 (9739) 9739..9933 - 195 WP_000796505.1 hypothetical protein -
PIB66_RS23865 (9907) 9907..10347 + 441 Protein_14 zinc-binding dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(B) / dfrA1 / blaCTX-M-14 / qacE / cmlA1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1B - 1..151807 151807


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T268141 WP_000421272.1 NZ_CP116137:c5526-5251 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT268141 WP_001387467.1 NZ_CP116137:c5810-5526 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References