Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4506714..4507546 | Replicon | chromosome |
| Accession | NZ_CP116136 | ||
| Organism | Escherichia coli strain DETEC-P649 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | PIB66_RS21470 | Protein ID | WP_000854753.1 |
| Coordinates | 4507172..4507546 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | PIB66_RS21465 | Protein ID | WP_001540478.1 |
| Coordinates | 4506714..4507082 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB66_RS21430 (4502546) | 4502546..4503226 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| PIB66_RS21435 (4503374) | 4503374..4504051 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| PIB66_RS21440 (4504057) | 4504057..4504290 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| PIB66_RS21445 (4504380) | 4504380..4505198 | + | 819 | WP_023909075.1 | DUF932 domain-containing protein | - |
| PIB66_RS21450 (4505290) | 4505290..4505775 | + | 486 | WP_001586019.1 | antirestriction protein | - |
| PIB66_RS21455 (4505791) | 4505791..4506267 | + | 477 | WP_001186773.1 | RadC family protein | - |
| PIB66_RS21460 (4506330) | 4506330..4506551 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| PIB66_RS21465 (4506714) | 4506714..4507082 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIB66_RS21470 (4507172) | 4507172..4507546 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| PIB66_RS21475 (4507543) | 4507543..4508031 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| PIB66_RS21480 (4508043) | 4508043..4508240 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| PIB66_RS21485 (4508337) | 4508337..4508906 | + | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
| PIB66_RS21490 (4509655) | 4509655..4511193 | + | 1539 | WP_001187178.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4494597..4519006 | 24409 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T268138 WP_000854753.1 NZ_CP116136:4507172-4507546 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT268138 WP_001540478.1 NZ_CP116136:4506714-4507082 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |