Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3268205..3268910 | Replicon | chromosome |
Accession | NZ_CP116136 | ||
Organism | Escherichia coli strain DETEC-P649 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | PIB66_RS15720 | Protein ID | WP_000539521.1 |
Coordinates | 3268205..3268591 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PIB66_RS15725 | Protein ID | WP_001280945.1 |
Coordinates | 3268581..3268910 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB66_RS15700 (3264209) | 3264209..3264835 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
PIB66_RS15705 (3264832) | 3264832..3265947 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
PIB66_RS15710 (3266058) | 3266058..3266441 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
PIB66_RS15715 (3266654) | 3266654..3267979 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
PIB66_RS15720 (3268205) | 3268205..3268591 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PIB66_RS15725 (3268581) | 3268581..3268910 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
PIB66_RS15730 (3268980) | 3268980..3270308 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
PIB66_RS15735 (3270316) | 3270316..3272664 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
PIB66_RS15740 (3272842) | 3272842..3273753 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T268132 WP_000539521.1 NZ_CP116136:3268205-3268591 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|