Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 3012964..3013748 | Replicon | chromosome |
Accession | NZ_CP116136 | ||
Organism | Escherichia coli strain DETEC-P649 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | PIB66_RS14510 | Protein ID | WP_000613626.1 |
Coordinates | 3013254..3013748 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | PIB66_RS14505 | Protein ID | WP_001110447.1 |
Coordinates | 3012964..3013257 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB66_RS14495 (3008114) | 3008114..3009073 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
PIB66_RS14500 (3009646) | 3009646..3012831 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
PIB66_RS14505 (3012964) | 3012964..3013257 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
PIB66_RS14510 (3013254) | 3013254..3013748 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
PIB66_RS14515 (3013843) | 3013843..3014796 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
PIB66_RS14520 (3014808) | 3014808..3016451 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
PIB66_RS14525 (3016517) | 3016517..3017458 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
PIB66_RS14530 (3017458) | 3017458..3018555 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T268131 WP_000613626.1 NZ_CP116136:3013254-3013748 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|