Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1002399..1003053 | Replicon | chromosome |
| Accession | NZ_CP116136 | ||
| Organism | Escherichia coli strain DETEC-P649 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PIB66_RS04895 | Protein ID | WP_000244781.1 |
| Coordinates | 1002646..1003053 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIB66_RS04890 | Protein ID | WP_000354046.1 |
| Coordinates | 1002399..1002665 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB66_RS04870 (998487) | 998487..999920 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
| PIB66_RS04875 (999965) | 999965..1000276 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIB66_RS04880 (1000440) | 1000440..1001099 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PIB66_RS04885 (1001176) | 1001176..1002156 | - | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
| PIB66_RS04890 (1002399) | 1002399..1002665 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIB66_RS04895 (1002646) | 1002646..1003053 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PIB66_RS04900 (1003093) | 1003093..1003614 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIB66_RS04905 (1003726) | 1003726..1004622 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIB66_RS04910 (1004647) | 1004647..1005357 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIB66_RS04915 (1005363) | 1005363..1007096 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268122 WP_000244781.1 NZ_CP116136:1002646-1003053 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|