Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 860220..861055 Replicon chromosome
Accession NZ_CP116136
Organism Escherichia coli strain DETEC-P649

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2I6T1R7
Locus tag PIB66_RS04115 Protein ID WP_016231184.1
Coordinates 860220..860597 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7Z1I923
Locus tag PIB66_RS04120 Protein ID WP_016231183.1
Coordinates 860687..861055 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB66_RS04085 (855334) 855334..856482 - 1149 WP_000905926.1 capsule polysaccharide export inner-membrane protein KpsE -
PIB66_RS04090 (856554) 856554..857537 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
PIB66_RS04095 (858348) 858348..858518 - 171 Protein_803 IS110 family transposase -
PIB66_RS04100 (858860) 858860..859429 - 570 WP_016231187.1 DUF4942 domain-containing protein -
PIB66_RS04105 (859526) 859526..859723 - 198 WP_016231186.1 DUF957 domain-containing protein -
PIB66_RS04110 (859735) 859735..860223 - 489 WP_016231185.1 DUF5983 family protein -
PIB66_RS04115 (860220) 860220..860597 - 378 WP_016231184.1 TA system toxin CbtA family protein Toxin
PIB66_RS04120 (860687) 860687..861055 - 369 WP_016231183.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIB66_RS04125 (861105) 861105..861749 - 645 Protein_809 antitoxin of toxin-antitoxin stability system -
PIB66_RS04130 (861768) 861768..861989 - 222 WP_016231182.1 DUF987 domain-containing protein -
PIB66_RS04135 (862052) 862052..862528 - 477 WP_001186774.1 RadC family protein -
PIB66_RS04140 (862544) 862544..863029 - 486 WP_000849596.1 antirestriction protein -
PIB66_RS04145 (863084) 863084..863902 - 819 WP_023909039.1 DUF932 domain-containing protein -
PIB66_RS04150 (864002) 864002..864235 - 234 WP_001119719.1 DUF905 family protein -
PIB66_RS04155 (864321) 864321..864725 + 405 WP_016231180.1 transposase -
PIB66_RS04160 (864722) 864722..865069 + 348 WP_000612617.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14106.07 Da        Isoelectric Point: 8.2905

>T268121 WP_016231184.1 NZ_CP116136:c860597-860220 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13613.43 Da        Isoelectric Point: 6.8413

>AT268121 WP_016231183.1 NZ_CP116136:c861055-860687 [Escherichia coli]
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I6T1R7

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z1I923

References