Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 28021..28486 Replicon plasmid pDETEC36
Accession NZ_CP116128
Organism Escherichia coli strain DETEC-P666

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag PIB57_RS25610 Protein ID WP_001230707.1
Coordinates 28021..28272 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag PIB57_RS25615 Protein ID WP_000801440.1
Coordinates 28259..28486 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB57_RS25585 (PIB57_25590) 23215..23742 - 528 WP_000577044.1 DUF2726 domain-containing protein -
PIB57_RS25590 (PIB57_25595) 23878..24282 - 405 WP_063270189.1 hypothetical protein -
PIB57_RS25595 (PIB57_25600) 24295..25164 - 870 WP_271291424.1 replication initiation protein -
PIB57_RS25600 (PIB57_25605) 26862..27377 + 516 WP_001025395.1 J domain-containing protein -
PIB57_RS25605 (PIB57_25610) 27482..28024 + 543 WP_001083906.1 hypothetical protein -
PIB57_RS25610 (PIB57_25615) 28021..28272 + 252 WP_001230707.1 hypothetical protein Toxin
PIB57_RS25615 (PIB57_25620) 28259..28486 + 228 WP_000801440.1 hypothetical protein Antitoxin
PIB57_RS25620 (PIB57_25625) 28488..28808 + 321 WP_224693477.1 molecular chaperone DnaJ -
PIB57_RS25625 (PIB57_25630) 28935..29207 + 273 WP_001272373.1 hypothetical protein -
PIB57_RS25630 (PIB57_25635) 29275..29580 + 306 WP_072182957.1 hypothetical protein -
PIB57_RS25635 (PIB57_25640) 29886..30134 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
PIB57_RS25640 (PIB57_25645) 30131..30478 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..30896 30896


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T268116 WP_001230707.1 NZ_CP116128:28021-28272 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT268116 WP_000801440.1 NZ_CP116128:28259-28486 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References