Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3674090..3674708 | Replicon | chromosome |
| Accession | NZ_CP116123 | ||
| Organism | Escherichia coli strain DETEC-P666 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIB57_RS17510 | Protein ID | WP_001291435.1 |
| Coordinates | 3674490..3674708 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIB57_RS17505 | Protein ID | WP_000344800.1 |
| Coordinates | 3674090..3674464 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB57_RS17495 (3669179) | 3669179..3670372 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PIB57_RS17500 (3670395) | 3670395..3673544 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| PIB57_RS17505 (3674090) | 3674090..3674464 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIB57_RS17510 (3674490) | 3674490..3674708 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIB57_RS17515 (3674880) | 3674880..3675431 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| PIB57_RS17520 (3675547) | 3675547..3676017 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PIB57_RS17525 (3676181) | 3676181..3677731 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIB57_RS17530 (3677773) | 3677773..3678126 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
| PIB57_RS17540 (3678505) | 3678505..3678816 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| PIB57_RS17545 (3678847) | 3678847..3679419 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268100 WP_001291435.1 NZ_CP116123:3674490-3674708 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268100 WP_000344800.1 NZ_CP116123:3674090-3674464 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |