Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2622408..2623046 | Replicon | chromosome |
| Accession | NZ_CP116123 | ||
| Organism | Escherichia coli strain DETEC-P666 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | PIB57_RS12490 | Protein ID | WP_000813795.1 |
| Coordinates | 2622870..2623046 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PIB57_RS12485 | Protein ID | WP_076797675.1 |
| Coordinates | 2622408..2622824 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB57_RS12465 (2617560) | 2617560..2618501 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| PIB57_RS12470 (2618502) | 2618502..2619515 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| PIB57_RS12475 (2619533) | 2619533..2620678 | - | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| PIB57_RS12480 (2620923) | 2620923..2622329 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| PIB57_RS12485 (2622408) | 2622408..2622824 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PIB57_RS12490 (2622870) | 2622870..2623046 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PIB57_RS12495 (2623268) | 2623268..2623498 | + | 231 | WP_023910283.1 | YncJ family protein | - |
| PIB57_RS12500 (2623590) | 2623590..2625551 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PIB57_RS12505 (2625624) | 2625624..2626160 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| PIB57_RS12510 (2626252) | 2626252..2627424 | + | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T268097 WP_000813795.1 NZ_CP116123:c2623046-2622870 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT268097 WP_076797675.1 NZ_CP116123:c2622824-2622408 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|