Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 860221..861056 | Replicon | chromosome |
Accession | NZ_CP116123 | ||
Organism | Escherichia coli strain DETEC-P666 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2I6T1R7 |
Locus tag | PIB57_RS04115 | Protein ID | WP_016231184.1 |
Coordinates | 860221..860598 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A7Z1I923 |
Locus tag | PIB57_RS04120 | Protein ID | WP_016231183.1 |
Coordinates | 860688..861056 (-) | Length | 123 a.a. |
Genomic Context
Location: 864322..864726 (405 bp)
Type: Others
Protein ID: WP_016231180.1
Type: Others
Protein ID: WP_016231180.1
Location: 864723..865070 (348 bp)
Type: Others
Protein ID: WP_000612617.1
Type: Others
Protein ID: WP_000612617.1
Location: 855335..856483 (1149 bp)
Type: Others
Protein ID: WP_000905926.1
Type: Others
Protein ID: WP_000905926.1
Location: 856555..857538 (984 bp)
Type: Others
Protein ID: WP_001298261.1
Type: Others
Protein ID: WP_001298261.1
Location: 858349..858519 (171 bp)
Type: Others
Protein ID: Protein_803
Type: Others
Protein ID: Protein_803
Location: 858861..859430 (570 bp)
Type: Others
Protein ID: WP_001290252.1
Type: Others
Protein ID: WP_001290252.1
Location: 859527..859724 (198 bp)
Type: Others
Protein ID: WP_016231186.1
Type: Others
Protein ID: WP_016231186.1
Location: 859736..860224 (489 bp)
Type: Others
Protein ID: WP_016231185.1
Type: Others
Protein ID: WP_016231185.1
Location: 860221..860598 (378 bp)
Type: Toxin
Protein ID: WP_016231184.1
Type: Toxin
Protein ID: WP_016231184.1
Location: 860688..861056 (369 bp)
Type: Antitoxin
Protein ID: WP_016231183.1
Type: Antitoxin
Protein ID: WP_016231183.1
Location: 861106..861750 (645 bp)
Type: Others
Protein ID: Protein_809
Type: Others
Protein ID: Protein_809
Location: 861769..861990 (222 bp)
Type: Others
Protein ID: WP_016231182.1
Type: Others
Protein ID: WP_016231182.1
Location: 862053..862529 (477 bp)
Type: Others
Protein ID: WP_001186774.1
Type: Others
Protein ID: WP_001186774.1
Location: 862545..863030 (486 bp)
Type: Others
Protein ID: WP_000849596.1
Type: Others
Protein ID: WP_000849596.1
Location: 863085..863903 (819 bp)
Type: Others
Protein ID: WP_023909039.1
Type: Others
Protein ID: WP_023909039.1
Location: 864003..864236 (234 bp)
Type: Others
Protein ID: WP_001119719.1
Type: Others
Protein ID: WP_001119719.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB57_RS04085 (855335) | 855335..856483 | - | 1149 | WP_000905926.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
PIB57_RS04090 (856555) | 856555..857538 | - | 984 | WP_001298261.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
PIB57_RS04095 (858349) | 858349..858519 | - | 171 | Protein_803 | IS110 family transposase | - |
PIB57_RS04100 (858861) | 858861..859430 | - | 570 | WP_001290252.1 | DUF4942 domain-containing protein | - |
PIB57_RS04105 (859527) | 859527..859724 | - | 198 | WP_016231186.1 | DUF957 domain-containing protein | - |
PIB57_RS04110 (859736) | 859736..860224 | - | 489 | WP_016231185.1 | DUF5983 family protein | - |
PIB57_RS04115 (860221) | 860221..860598 | - | 378 | WP_016231184.1 | TA system toxin CbtA family protein | Toxin |
PIB57_RS04120 (860688) | 860688..861056 | - | 369 | WP_016231183.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIB57_RS04125 (861106) | 861106..861750 | - | 645 | Protein_809 | antitoxin of toxin-antitoxin stability system | - |
PIB57_RS04130 (861769) | 861769..861990 | - | 222 | WP_016231182.1 | DUF987 domain-containing protein | - |
PIB57_RS04135 (862053) | 862053..862529 | - | 477 | WP_001186774.1 | RadC family protein | - |
PIB57_RS04140 (862545) | 862545..863030 | - | 486 | WP_000849596.1 | antirestriction protein | - |
PIB57_RS04145 (863085) | 863085..863903 | - | 819 | WP_023909039.1 | DUF932 domain-containing protein | - |
PIB57_RS04150 (864003) | 864003..864236 | - | 234 | WP_001119719.1 | DUF905 family protein | - |
PIB57_RS04155 (864322) | 864322..864726 | + | 405 | WP_016231180.1 | transposase | - |
PIB57_RS04160 (864723) | 864723..865070 | + | 348 | WP_000612617.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14106.07 Da Isoelectric Point: 8.2905
>T268088 WP_016231184.1 NZ_CP116123:c860598-860221 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13613.43 Da Isoelectric Point: 6.8413
>AT268088 WP_016231183.1 NZ_CP116123:c861056-860688 [Escherichia coli]
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ
Download Length: 369 bp
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I6T1R7 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z1I923 |