Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 72580..73414 | Replicon | chromosome |
| Accession | NZ_CP116123 | ||
| Organism | Escherichia coli strain DETEC-P666 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A4S3WCD6 |
| Locus tag | PIB57_RS00315 | Protein ID | WP_021566610.1 |
| Coordinates | 72580..72957 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | PIB57_RS00320 | Protein ID | WP_001285585.1 |
| Coordinates | 73046..73414 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB57_RS00285 (67947) | 67947..68870 | - | 924 | WP_000535949.1 | carboxylate/amino acid/amine transporter | - |
| PIB57_RS00290 (68981) | 68981..70165 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| PIB57_RS00295 (70570) | 70570..70775 | - | 206 | Protein_58 | RhuM family protein | - |
| PIB57_RS00300 (70956) | 70956..71801 | - | 846 | WP_021566612.1 | DUF4942 domain-containing protein | - |
| PIB57_RS00305 (71886) | 71886..72083 | - | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
| PIB57_RS00310 (72095) | 72095..72583 | - | 489 | WP_048237286.1 | DUF5983 family protein | - |
| PIB57_RS00315 (72580) | 72580..72957 | - | 378 | WP_021566610.1 | TA system toxin CbtA family protein | Toxin |
| PIB57_RS00320 (73046) | 73046..73414 | - | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PIB57_RS00325 (73488) | 73488..73709 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| PIB57_RS00330 (73772) | 73772..74248 | - | 477 | WP_001186726.1 | RadC family protein | - |
| PIB57_RS00335 (74264) | 74264..74743 | - | 480 | WP_048265132.1 | antirestriction protein | - |
| PIB57_RS00340 (74825) | 74825..75643 | - | 819 | WP_001234629.1 | DUF932 domain-containing protein | - |
| PIB57_RS00345 (75743) | 75743..75976 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| PIB57_RS00350 (76055) | 76055..76509 | - | 455 | Protein_69 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.02 Da Isoelectric Point: 7.8276
>T268084 WP_021566610.1 NZ_CP116123:c72957-72580 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S3WCD6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |