Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 55076..55719 | Replicon | plasmid pDETEC15 |
| Accession | NZ_CP116118 | ||
| Organism | Escherichia coli strain DETEC-P793 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | PIC92_RS26435 | Protein ID | WP_001034044.1 |
| Coordinates | 55303..55719 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | PIC92_RS26430 | Protein ID | WP_001261286.1 |
| Coordinates | 55076..55306 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC92_RS26415 (PIC92_26420) | 50213..50443 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIC92_RS26420 (PIC92_26425) | 50440..50856 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
| PIC92_RS26425 (PIC92_26430) | 50901..54695 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
| PIC92_RS26430 (PIC92_26435) | 55076..55306 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIC92_RS26435 (PIC92_26440) | 55303..55719 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC92_RS26440 (PIC92_26445) | 55794..57359 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| PIC92_RS26445 (PIC92_26450) | 57344..58366 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| PIC92_RS26455 (PIC92_26460) | 59620..60317 | + | 698 | WP_223155668.1 | IS1-like element IS1A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | senB | 1..82761 | 82761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T268083 WP_001034044.1 NZ_CP116118:55303-55719 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |