Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 50213..50856 | Replicon | plasmid pDETEC15 |
Accession | NZ_CP116118 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | PIC92_RS26420 | Protein ID | WP_001034046.1 |
Coordinates | 50440..50856 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | PIC92_RS26415 | Protein ID | WP_001261278.1 |
Coordinates | 50213..50443 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS26385 (PIC92_26390) | 45724..46029 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | - |
PIC92_RS26390 (PIC92_26395) | 46031..46249 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | - |
PIC92_RS26395 (PIC92_26400) | 46816..47328 | + | 513 | WP_000151784.1 | hypothetical protein | - |
PIC92_RS26400 (PIC92_26405) | 47362..48495 | - | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
PIC92_RS26405 (PIC92_26410) | 48662..49435 | - | 774 | WP_000905949.1 | hypothetical protein | - |
PIC92_RS26410 (PIC92_26415) | 49448..49948 | - | 501 | WP_001773886.1 | HEPN family nuclease | - |
PIC92_RS26415 (PIC92_26420) | 50213..50443 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PIC92_RS26420 (PIC92_26425) | 50440..50856 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC92_RS26425 (PIC92_26430) | 50901..54695 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
PIC92_RS26430 (PIC92_26435) | 55076..55306 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC92_RS26435 (PIC92_26440) | 55303..55719 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | senB | 1..82761 | 82761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T268082 WP_001034046.1 NZ_CP116118:50440-50856 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |