Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 50213..50856 Replicon plasmid pDETEC15
Accession NZ_CP116118
Organism Escherichia coli strain DETEC-P793

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PIC92_RS26420 Protein ID WP_001034046.1
Coordinates 50440..50856 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PIC92_RS26415 Protein ID WP_001261278.1
Coordinates 50213..50443 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC92_RS26385 (PIC92_26390) 45724..46029 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PIC92_RS26390 (PIC92_26395) 46031..46249 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PIC92_RS26395 (PIC92_26400) 46816..47328 + 513 WP_000151784.1 hypothetical protein -
PIC92_RS26400 (PIC92_26405) 47362..48495 - 1134 WP_001542067.1 DUF3800 domain-containing protein -
PIC92_RS26405 (PIC92_26410) 48662..49435 - 774 WP_000905949.1 hypothetical protein -
PIC92_RS26410 (PIC92_26415) 49448..49948 - 501 WP_001773886.1 HEPN family nuclease -
PIC92_RS26415 (PIC92_26420) 50213..50443 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC92_RS26420 (PIC92_26425) 50440..50856 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC92_RS26425 (PIC92_26430) 50901..54695 - 3795 WP_001144732.1 hypothetical protein -
PIC92_RS26430 (PIC92_26435) 55076..55306 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC92_RS26435 (PIC92_26440) 55303..55719 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - senB 1..82761 82761


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T268082 WP_001034046.1 NZ_CP116118:50440-50856 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT268082 WP_001261278.1 NZ_CP116118:50213-50443 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References