Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 41064..41824 | Replicon | plasmid pDETEC13 |
Accession | NZ_CP116116 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | PIC92_RS24800 | Protein ID | WP_271293057.1 |
Coordinates | 41339..41824 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | PIC92_RS24795 | Protein ID | WP_271293067.1 |
Coordinates | 41064..41351 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS24770 (PIC92_24770) | 36143..37512 | + | 1370 | WP_271293055.1 | IS3 family transposase | - |
PIC92_RS24775 (PIC92_24775) | 37670..39094 | - | 1425 | WP_105667421.1 | MFS transporter | - |
PIC92_RS24780 (PIC92_24780) | 39205..39765 | + | 561 | WP_271293056.1 | MarR family transcriptional regulator | - |
PIC92_RS24785 (PIC92_24785) | 39709..40683 | - | 975 | WP_012478345.1 | IS30-like element ISApl1 family transposase | - |
PIC92_RS24790 (PIC92_24790) | 40763..40939 | + | 177 | Protein_52 | MarR family transcriptional regulator | - |
PIC92_RS24795 (PIC92_24795) | 41064..41351 | + | 288 | WP_271293067.1 | DUF1778 domain-containing protein | Antitoxin |
PIC92_RS24800 (PIC92_24800) | 41339..41824 | + | 486 | WP_271293057.1 | GNAT family N-acetyltransferase | Toxin |
PIC92_RS24805 (PIC92_24805) | 42104..42256 | + | 153 | Protein_55 | DUF5431 family protein | - |
PIC92_RS24810 (PIC92_24810) | 42201..42323 | + | 123 | WP_085842394.1 | Hok/Gef family protein | - |
PIC92_RS24815 (PIC92_24815) | 42928..43902 | + | 975 | WP_207304325.1 | Hok/Gef family protein | - |
PIC92_RS24820 (PIC92_24820) | 43886..44008 | + | 123 | WP_254911979.1 | hypothetical protein | - |
PIC92_RS24825 (PIC92_24825) | 44100..44444 | - | 345 | WP_223383365.1 | phosphonate ABC transporter substrate-binding protein | - |
PIC92_RS24830 (PIC92_24830) | 44708..45004 | + | 297 | WP_271293058.1 | hydrogenase expression/formation protein HypD | - |
PIC92_RS24835 (PIC92_24835) | 45073..46140 | + | 1068 | WP_064190237.1 | hypothetical protein | - |
PIC92_RS24840 (PIC92_24840) | 46251..46751 | - | 501 | WP_064190236.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | pla | 1..209927 | 209927 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17680.47 Da Isoelectric Point: 9.8566
>T268076 WP_271293057.1 NZ_CP116116:41339-41824 [Escherichia coli]
VGCVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PNPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
VGCVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PNPIPVIILARLAVDLSFRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|