Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3827828..3828482 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PIC92_RS18750 | Protein ID | WP_000244781.1 |
Coordinates | 3827828..3828235 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIC92_RS18755 | Protein ID | WP_000354046.1 |
Coordinates | 3828216..3828482 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS18730 (3823785) | 3823785..3825518 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PIC92_RS18735 (3825524) | 3825524..3826234 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIC92_RS18740 (3826259) | 3826259..3827155 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PIC92_RS18745 (3827267) | 3827267..3827788 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIC92_RS18750 (3827828) | 3827828..3828235 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
PIC92_RS18755 (3828216) | 3828216..3828482 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIC92_RS18760 (3828725) | 3828725..3829705 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
PIC92_RS18765 (3829782) | 3829782..3830441 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PIC92_RS18770 (3830605) | 3830605..3830916 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
PIC92_RS18775 (3830961) | 3830961..3832394 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T268071 WP_000244781.1 NZ_CP116115:c3828235-3827828 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|