Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 3672011..3672594 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | PIC92_RS18125 | Protein ID | WP_000254749.1 |
Coordinates | 3672011..3672346 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PIC92_RS18130 | Protein ID | WP_000581937.1 |
Coordinates | 3672346..3672594 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS18110 (3667897) | 3667897..3669195 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PIC92_RS18115 (3669283) | 3669283..3670920 | - | 1638 | WP_001774030.1 | CTP synthase (glutamine hydrolyzing) | - |
PIC92_RS18120 (3671148) | 3671148..3671939 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIC92_RS18125 (3672011) | 3672011..3672346 | - | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
PIC92_RS18130 (3672346) | 3672346..3672594 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIC92_RS18135 (3672672) | 3672672..3674906 | - | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
PIC92_RS18140 (3674954) | 3674954..3676255 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T268070 WP_000254749.1 NZ_CP116115:c3672346-3672011 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|