Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 316488..317320 | Replicon | chromosome |
Accession | NZ_CP116115 | ||
Organism | Escherichia coli strain DETEC-P793 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PD64 |
Locus tag | PIC92_RS01445 | Protein ID | WP_000854753.1 |
Coordinates | 316488..316862 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NQ68 |
Locus tag | PIC92_RS01450 | Protein ID | WP_001540478.1 |
Coordinates | 316952..317320 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC92_RS01425 (312841) | 312841..314379 | - | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
PIC92_RS01430 (315128) | 315128..315697 | - | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
PIC92_RS01435 (315794) | 315794..315991 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
PIC92_RS01440 (316003) | 316003..316491 | - | 489 | WP_000777545.1 | DUF5983 family protein | - |
PIC92_RS01445 (316488) | 316488..316862 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
PIC92_RS01450 (316952) | 316952..317320 | - | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIC92_RS01455 (317483) | 317483..317704 | - | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
PIC92_RS01460 (317767) | 317767..318243 | - | 477 | WP_001186786.1 | RadC family protein | - |
PIC92_RS01465 (318259) | 318259..318744 | - | 486 | WP_000214398.1 | antirestriction protein | - |
PIC92_RS01470 (318835) | 318835..319653 | - | 819 | WP_001773857.1 | DUF932 domain-containing protein | - |
PIC92_RS01475 (319743) | 319743..319976 | - | 234 | WP_001278283.1 | DUF905 family protein | - |
PIC92_RS01480 (319982) | 319982..320659 | - | 678 | WP_001097301.1 | hypothetical protein | - |
PIC92_RS01485 (320807) | 320807..321487 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 305028..362652 | 57624 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T268053 WP_000854753.1 NZ_CP116115:c316862-316488 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT268053 WP_001540478.1 NZ_CP116115:c317320-316952 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LVU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NQ68 |