Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 169758..170401 | Replicon | plasmid pDETEC66 |
Accession | NZ_CP116108 | ||
Organism | Escherichia coli strain DETEC-P829 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | PIC05_RS25820 | Protein ID | WP_001034044.1 |
Coordinates | 169985..170401 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | PIC05_RS25815 | Protein ID | WP_072647566.1 |
Coordinates | 169758..169988 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC05_RS25795 (165320) | 165320..166009 | - | 690 | WP_001513524.1 | RES family NAD+ phosphorylase | - |
PIC05_RS25800 (166428) | 166428..166658 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC05_RS25805 (166655) | 166655..167071 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | - |
PIC05_RS25810 (167233) | 167233..169371 | - | 2139 | WP_001513523.1 | AAA family ATPase | - |
PIC05_RS25815 (169758) | 169758..169988 | + | 231 | WP_072647566.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PIC05_RS25820 (169985) | 169985..170401 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC05_RS25825 (170476) | 170476..172041 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
PIC05_RS25830 (172026) | 172026..173048 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..194772 | 194772 | |
- | flank | IS/Tn | - | - | 173302..173805 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T268014 WP_001034044.1 NZ_CP116108:169985-170401 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|