Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 166428..167071 Replicon plasmid pDETEC66
Accession NZ_CP116108
Organism Escherichia coli strain DETEC-P829

Toxin (Protein)


Gene name vagD Uniprot ID B1LRW4
Locus tag PIC05_RS25805 Protein ID WP_001044768.1
Coordinates 166655..167071 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D2WFK3
Locus tag PIC05_RS25800 Protein ID WP_001261287.1
Coordinates 166428..166658 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC05_RS25770 (161923) 161923..162072 - 150 Protein_182 RepB family plasmid replication initiator protein -
PIC05_RS25775 (162772) 162772..163518 - 747 WP_072748653.1 site-specific integrase -
PIC05_RS25780 (163519) 163519..163824 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
PIC05_RS25785 (163826) 163826..164044 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
PIC05_RS25790 (164600) 164600..165289 + 690 WP_001513525.1 helix-turn-helix domain-containing protein -
PIC05_RS25795 (165320) 165320..166009 - 690 WP_001513524.1 RES family NAD+ phosphorylase -
PIC05_RS25800 (166428) 166428..166658 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC05_RS25805 (166655) 166655..167071 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC05_RS25810 (167233) 167233..169371 - 2139 WP_001513523.1 AAA family ATPase -
PIC05_RS25815 (169758) 169758..169988 + 231 WP_072647566.1 type II toxin-antitoxin system VapB family antitoxin -
PIC05_RS25820 (169985) 169985..170401 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
PIC05_RS25825 (170476) 170476..172041 + 1566 WP_001128474.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..194772 194772


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15197.66 Da        Isoelectric Point: 7.7805

>T268013 WP_001044768.1 NZ_CP116108:166655-167071 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8815.90 Da        Isoelectric Point: 4.3775

>AT268013 WP_001261287.1 NZ_CP116108:166428-166658 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLEYEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A606Q844

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9QFC4

References