Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 166428..167071 | Replicon | plasmid pDETEC66 |
| Accession | NZ_CP116108 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | PIC05_RS25805 | Protein ID | WP_001044768.1 |
| Coordinates | 166655..167071 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | PIC05_RS25800 | Protein ID | WP_001261287.1 |
| Coordinates | 166428..166658 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS25770 (161923) | 161923..162072 | - | 150 | Protein_182 | RepB family plasmid replication initiator protein | - |
| PIC05_RS25775 (162772) | 162772..163518 | - | 747 | WP_072748653.1 | site-specific integrase | - |
| PIC05_RS25780 (163519) | 163519..163824 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| PIC05_RS25785 (163826) | 163826..164044 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| PIC05_RS25790 (164600) | 164600..165289 | + | 690 | WP_001513525.1 | helix-turn-helix domain-containing protein | - |
| PIC05_RS25795 (165320) | 165320..166009 | - | 690 | WP_001513524.1 | RES family NAD+ phosphorylase | - |
| PIC05_RS25800 (166428) | 166428..166658 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PIC05_RS25805 (166655) | 166655..167071 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC05_RS25810 (167233) | 167233..169371 | - | 2139 | WP_001513523.1 | AAA family ATPase | - |
| PIC05_RS25815 (169758) | 169758..169988 | + | 231 | WP_072647566.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIC05_RS25820 (169985) | 169985..170401 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| PIC05_RS25825 (170476) | 170476..172041 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..194772 | 194772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T268013 WP_001044768.1 NZ_CP116108:166655-167071 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |