Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 163519..164044 Replicon plasmid pDETEC66
Accession NZ_CP116108
Organism Escherichia coli strain DETEC-P829

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag PIC05_RS25780 Protein ID WP_001159871.1
Coordinates 163519..163824 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag PIC05_RS25785 Protein ID WP_000813630.1
Coordinates 163826..164044 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC05_RS25750 (158777) 158777..158989 - 213 WP_001523378.1 hypothetical protein -
PIC05_RS25755 (159718) 159718..159975 + 258 WP_015387373.1 hypothetical protein -
PIC05_RS25760 (160071) 160071..160517 - 447 WP_000616196.1 hypothetical protein -
PIC05_RS25765 (160682) 160682..161910 + 1229 WP_169052773.1 IS3-like element IS2 family transposase -
PIC05_RS25770 (161923) 161923..162072 - 150 Protein_182 RepB family plasmid replication initiator protein -
PIC05_RS25775 (162772) 162772..163518 - 747 WP_072748653.1 site-specific integrase -
PIC05_RS25780 (163519) 163519..163824 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
PIC05_RS25785 (163826) 163826..164044 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
PIC05_RS25790 (164600) 164600..165289 + 690 WP_001513525.1 helix-turn-helix domain-containing protein -
PIC05_RS25795 (165320) 165320..166009 - 690 WP_001513524.1 RES family NAD+ phosphorylase -
PIC05_RS25800 (166428) 166428..166658 + 231 WP_001261287.1 type II toxin-antitoxin system VapB family antitoxin -
PIC05_RS25805 (166655) 166655..167071 + 417 WP_001044768.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..194772 194772


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T268012 WP_001159871.1 NZ_CP116108:c163824-163519 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT268012 WP_000813630.1 NZ_CP116108:c164044-163826 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References