Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 104637..105262 | Replicon | plasmid pDETEC66 |
| Accession | NZ_CP116108 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PIC05_RS25405 | Protein ID | WP_000911313.1 |
| Coordinates | 104864..105262 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | PIC05_RS25400 | Protein ID | WP_000450520.1 |
| Coordinates | 104637..104864 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS25400 (104637) | 104637..104864 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PIC05_RS25405 (104864) | 104864..105262 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC05_RS25410 (105271) | 105271..107469 | - | 2199 | WP_001593043.1 | type IV conjugative transfer system coupling protein TraD | - |
| PIC05_RS25415 (107722) | 107722..108453 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| PIC05_RS25420 (108485) | 108485..108982 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..194772 | 194772 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T268008 WP_000911313.1 NZ_CP116108:104864-105262 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|