Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 92092..92627 Replicon plasmid pDETEC66
Accession NZ_CP116108
Organism Escherichia coli strain DETEC-P829

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag PIC05_RS25330 Protein ID WP_000222760.1
Coordinates 92092..92379 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag PIC05_RS25335 Protein ID WP_001132900.1
Coordinates 92376..92627 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC05_RS25300 (87812) 87812..88653 - 842 Protein_88 hypothetical protein -
PIC05_RS25305 (88996) 88996..89360 + 365 Protein_89 IS1 family transposase -
PIC05_RS25310 (89415) 89415..90197 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
PIC05_RS25315 (90194) 90194..91216 - 1023 WP_000255946.1 IS21-like element IS100 family transposase -
PIC05_RS25320 (91305) 91305..91652 + 348 Protein_92 IS1-like element IS1A family transposase -
PIC05_RS25325 (91668) 91668..91988 - 321 Protein_93 serine acetyltransferase -
PIC05_RS25330 (92092) 92092..92379 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PIC05_RS25335 (92376) 92376..92627 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PIC05_RS25340 (93590) 93590..94447 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PIC05_RS25345 (94440) 94440..94922 - 483 WP_001273588.1 hypothetical protein -
PIC05_RS25350 (94915) 94915..94962 - 48 WP_229471593.1 hypothetical protein -
PIC05_RS25355 (94953) 94953..95204 + 252 WP_223195197.1 replication protein RepA -
PIC05_RS25360 (95221) 95221..95478 - 258 WP_000083845.1 replication regulatory protein RepA -
PIC05_RS25365 (95762) 95762..95911 - 150 WP_001312851.1 Hok/Gef family protein -
- (95955) 95955..96016 + 62 NuclAT_1 - -
- (95955) 95955..96016 + 62 NuclAT_1 - -
- (95955) 95955..96016 + 62 NuclAT_1 - -
- (95955) 95955..96016 + 62 NuclAT_1 - -
PIC05_RS25370 (96272) 96272..96346 - 75 Protein_102 endonuclease -
PIC05_RS25375 (96592) 96592..96804 - 213 WP_001299730.1 ANR family transcriptional regulator -
PIC05_RS25380 (96940) 96940..97500 - 561 WP_000139315.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..194772 194772


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T268003 WP_000222760.1 NZ_CP116108:c92379-92092 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT268003 WP_001132900.1 NZ_CP116108:c92627-92376 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References