Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4158033..4158865 | Replicon | chromosome |
Accession | NZ_CP116106 | ||
Organism | Escherichia coli strain DETEC-P829 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A836ZBT7 |
Locus tag | PIC05_RS20205 | Protein ID | WP_001598217.1 |
Coordinates | 4158033..4158407 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PIC05_RS20210 | Protein ID | WP_001598216.1 |
Coordinates | 4158497..4158865 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC05_RS20165 (4153663) | 4153663..4154643 | + | 981 | WP_000379695.1 | sialate O-acetylesterase | - |
PIC05_RS20170 (4154651) | 4154651..4154755 | - | 105 | Protein_3943 | HNH endonuclease | - |
PIC05_RS20175 (4154855) | 4154855..4154998 | + | 144 | Protein_3944 | HNH endonuclease | - |
PIC05_RS20180 (4155766) | 4155766..4155915 | - | 150 | Protein_3945 | hypothetical protein | - |
PIC05_RS20185 (4156000) | 4156000..4156125 | - | 126 | Protein_3946 | hypothetical protein | - |
PIC05_RS20195 (4157429) | 4157429..4157533 | - | 105 | Protein_3948 | hypothetical protein | - |
PIC05_RS20200 (4157545) | 4157545..4158036 | - | 492 | WP_001598218.1 | DUF5983 family protein | - |
PIC05_RS20205 (4158033) | 4158033..4158407 | - | 375 | WP_001598217.1 | TA system toxin CbtA family protein | Toxin |
PIC05_RS20210 (4158497) | 4158497..4158865 | - | 369 | WP_001598216.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIC05_RS20215 (4158945) | 4158945..4159166 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
PIC05_RS20220 (4159235) | 4159235..4159711 | - | 477 | WP_032198294.1 | RadC family protein | - |
PIC05_RS20225 (4159727) | 4159727..4160212 | - | 486 | WP_000206667.1 | antirestriction protein | - |
PIC05_RS20230 (4160304) | 4160304..4161122 | - | 819 | WP_001598214.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimE / fimB | 4148624..4192313 | 43689 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13990.98 Da Isoelectric Point: 7.8045
>T267999 WP_001598217.1 NZ_CP116106:c4158407-4158033 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKTLPDTHVREASRCPSPVTIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13605.40 Da Isoelectric Point: 7.3992
>AT267999 WP_001598216.1 NZ_CP116106:c4158865-4158497 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSRGYVYMAVYPTPETKK
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSRGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|