Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3591590..3592427 | Replicon | chromosome |
Accession | NZ_CP116106 | ||
Organism | Escherichia coli strain DETEC-P829 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PIC05_RS17550 | Protein ID | WP_000227784.1 |
Coordinates | 3591885..3592427 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PIC05_RS17545 | Protein ID | WP_001297137.1 |
Coordinates | 3591590..3591901 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC05_RS17520 (3586610) | 3586610..3587557 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
PIC05_RS17525 (3587579) | 3587579..3589570 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PIC05_RS17530 (3589560) | 3589560..3590174 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PIC05_RS17535 (3590174) | 3590174..3590503 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PIC05_RS17540 (3590515) | 3590515..3591405 | + | 891 | WP_000971336.1 | heme o synthase | - |
PIC05_RS17545 (3591590) | 3591590..3591901 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PIC05_RS17550 (3591885) | 3591885..3592427 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PIC05_RS17555 (3592483) | 3592483..3593418 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
PIC05_RS17560 (3593826) | 3593826..3595190 | + | 1365 | WP_001000978.1 | MFS transporter | - |
PIC05_RS17565 (3595318) | 3595318..3595809 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PIC05_RS17570 (3595977) | 3595977..3596888 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T267997 WP_000227784.1 NZ_CP116106:3591885-3592427 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|