Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3557512..3558130 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIC05_RS17380 | Protein ID | WP_001291435.1 |
| Coordinates | 3557912..3558130 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIC05_RS17375 | Protein ID | WP_000344800.1 |
| Coordinates | 3557512..3557886 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS17365 (3552601) | 3552601..3553794 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PIC05_RS17370 (3553817) | 3553817..3556966 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| PIC05_RS17375 (3557512) | 3557512..3557886 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIC05_RS17380 (3557912) | 3557912..3558130 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIC05_RS17385 (3558302) | 3558302..3558853 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| PIC05_RS17390 (3558969) | 3558969..3559439 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PIC05_RS17395 (3559603) | 3559603..3561153 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIC05_RS17400 (3561195) | 3561195..3561548 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
| PIC05_RS17410 (3561927) | 3561927..3562238 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| PIC05_RS17415 (3562269) | 3562269..3562841 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267996 WP_001291435.1 NZ_CP116106:3557912-3558130 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267996 WP_000344800.1 NZ_CP116106:3557512-3557886 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |