Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2528691..2529329 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PIC05_RS12235 | Protein ID | WP_000813794.1 |
| Coordinates | 2529153..2529329 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PIC05_RS12230 | Protein ID | WP_001270286.1 |
| Coordinates | 2528691..2529107 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS12210 (2523843) | 2523843..2524784 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| PIC05_RS12215 (2524785) | 2524785..2525798 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
| PIC05_RS12220 (2525816) | 2525816..2526961 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| PIC05_RS12225 (2527206) | 2527206..2528612 | - | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| PIC05_RS12230 (2528691) | 2528691..2529107 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PIC05_RS12235 (2529153) | 2529153..2529329 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PIC05_RS12240 (2529551) | 2529551..2529781 | + | 231 | WP_000494239.1 | YncJ family protein | - |
| PIC05_RS12245 (2529873) | 2529873..2531834 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PIC05_RS12250 (2531907) | 2531907..2532443 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PIC05_RS12255 (2532535) | 2532535..2533710 | + | 1176 | WP_001236258.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T267995 WP_000813794.1 NZ_CP116106:c2529329-2529153 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT267995 WP_001270286.1 NZ_CP116106:c2529107-2528691 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|