Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1318206..1318831 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U9YZ02 |
| Locus tag | PIC05_RS06340 | Protein ID | WP_000911329.1 |
| Coordinates | 1318433..1318831 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | PIC05_RS06335 | Protein ID | WP_000450524.1 |
| Coordinates | 1318206..1318433 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS06310 (1314008) | 1314008..1314478 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| PIC05_RS06315 (1314478) | 1314478..1315050 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| PIC05_RS06320 (1315196) | 1315196..1316074 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| PIC05_RS06325 (1316091) | 1316091..1317125 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| PIC05_RS06330 (1317338) | 1317338..1318051 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PIC05_RS06335 (1318206) | 1318206..1318433 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PIC05_RS06340 (1318433) | 1318433..1318831 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PIC05_RS06345 (1318978) | 1318978..1319841 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
| PIC05_RS06350 (1319856) | 1319856..1321871 | + | 2016 | WP_000829393.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| PIC05_RS06355 (1321945) | 1321945..1322643 | + | 699 | WP_241226720.1 | esterase | - |
| PIC05_RS06360 (1322753) | 1322753..1322953 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T267989 WP_000911329.1 NZ_CP116106:1318433-1318831 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XW84 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CM33 |